General Information

  • ID:  hor005380
  • Uniprot ID:  O46227
  • Protein name:  Accessory gland peptide Acp33A
  • Gene name:  Acp33A
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  animal
  • Expression:  Main cells of accessory gland and seminal fluid.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007610 behavior; GO:0019953 sexual reproduction; GO:0045434 negative regulation of female receptivity, post-mating
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHTTESVLPDCVLYPRCLITKDPCCM
  • Length:  26
  • Propeptide:  MLPSKRVPFLFTIILFLAGLGQHTTESVLPDCVLYPRCLITKDPCCM
  • Signal peptide:  MLPSKRVPFLFTIILFLAGLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Responsible for physiological and behavioral changes in mated female flies.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O46227-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005380_AF2.pdbhor005380_ESM.pdb

Physical Information

Mass: 341263 Formula: C126H205N33O39S5
Absent amino acids: AFGNW Common amino acids: C
pI: 5.51 Basic residues: 3
Polar residues: 9 Hydrophobic residues: 6
Hydrophobicity: 6.15 Boman Index: -3094
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 82.31
Instability Index: 4203.08 Extinction Coefficient cystines: 1740
Absorbance 280nm: 69.6

Literature

  • PubMed ID:  9474779
  • Title:  New genes for male accessory gland proteins in Drosophila melanogaster.